|
Thermo Fisher
nhs peg4 biotin Nhs Peg4 Biotin, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pmc13097949-123-18-19?v=Thermo+Fisher Average 94 stars, based on 1 article reviews
nhs peg4 biotin - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
|
MedChemExpress
vqivyk peptide Vqivyk Peptide, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pm41621176-281-1-7?v=MedChemExpress Average 94 stars, based on 1 article reviews
vqivyk peptide - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
|
Alta Bioscience
cenp c mif2 1 38 mdymklglksrktgidvkqdipkdeysmeniddffkdd amide peptides ![]() Cenp C Mif2 1 38 Mdymklglksrktgidvkqdipkdeysmeniddffkdd Amide Peptides, supplied by Alta Bioscience, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pmc13065467-339-7-14?v=Alta+Bioscience Average 86 stars, based on 1 article reviews
cenp c mif2 1 38 mdymklglksrktgidvkqdipkdeysmeniddffkdd amide peptides - by Bioz Stars,
2026-07
86/100 stars
|
Buy from Supplier |
|
MedChemExpress
2 furoyl ligrlo nh2 peptide ![]() 2 Furoyl Ligrlo Nh2 Peptide, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pmc13052617-32-7-11?v=MedChemExpress Average 94 stars, based on 1 article reviews
2 furoyl ligrlo nh2 peptide - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
|
Tocris
agonist ligand ![]() Agonist Ligand, supplied by Tocris, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/us12441777-319-10-15?v=Tocris Average 93 stars, based on 1 article reviews
agonist ligand - by Bioz Stars,
2026-07
93/100 stars
|
Buy from Supplier |
|
Phoenix Pharmaceuticals
phoenixin 14 amide peptide ![]() Phoenixin 14 Amide Peptide, supplied by Phoenix Pharmaceuticals, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pm40816502-46-0-9?v=Phoenix+Pharmaceuticals Average 86 stars, based on 1 article reviews
phoenixin 14 amide peptide - by Bioz Stars,
2026-07
86/100 stars
|
Buy from Supplier |
|
MedChemExpress
peptide ![]() Peptide, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/us12391762-1046-2-3?v=MedChemExpress Average 94 stars, based on 1 article reviews
peptide - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
|
MedChemExpress
mog35 55 peptide ![]() Mog35 55 Peptide, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pmc12292834__sciadv%2Eadw2578_sm-144-0-6?v=MedChemExpress Average 93 stars, based on 1 article reviews
mog35 55 peptide - by Bioz Stars,
2026-07
93/100 stars
|
Buy from Supplier |
|
MedChemExpress
d ala peptide t amide dapta ![]() D Ala Peptide T Amide Dapta, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pmc12520528-161-9-12?v=MedChemExpress Average 93 stars, based on 1 article reviews
d ala peptide t amide dapta - by Bioz Stars,
2026-07
93/100 stars
|
Buy from Supplier |
|
MedChemExpress
d ala peptide t amide ![]() D Ala Peptide T Amide, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/peptide+amides/pmc12520528-88-4-7?v=MedChemExpress Average 92 stars, based on 1 article reviews
d ala peptide t amide - by Bioz Stars,
2026-07
92/100 stars
|
Buy from Supplier |
Journal: The Journal of Cell Biology
Article Title: Assembly and phosphoregulatory mechanisms of the budding yeast outer kinetochore KMN complex
doi: 10.1083/jcb.202506015
Figure Lengend Snippet: Regulation of Mis12c Mtw1c auto-inhibition by Aurora B kinase and its effect on the interaction with CENP-C Mif2 . (A) Structural alignment of the crystal structure of K. lactis CENP-C Mif2 residues 4–36 ( Kl CENP-C Mif2_4-36 ) as bound to the Kl Mis12c Mtw1c head 1 domain (PDB: 5T59 ) to the experimental model of Sc Mis12c Mtw1c (this study). The models are colored by chain; Mis12 Mtw1 and Nnf1 are colored identically in 5T59 and our experimentally determined model. Kl CENP-C Mif2_4-36 is shown in space filling representation to highlight lack of steric clash, and overlapping binding site, with Dsn1 AI . Only Kl CENP-C Mif2_4-36 is shown. (B) SEC elution chromatograms of attempts to reconstitute the interaction between Knl1c:Mis12c Mtw1c complexes containing different Dsn1 N-terminal truncation and/or phosphomimetic mutants and CENP-C Mif2 residues 1–63 (CENP-C Mif2_1-63 ) indicated within red boxes. (C) Coomassie brilliant blue–stained SDS-PAGE gels of the chromatograms shown in B. (B and C) K HB-RWD M = full-length Dsn1. K HB-RWD M 2E = full-length Dsn1 containing Dsn1 S240E and Dsn1 S250E phosphomimetic mutations. K HB-RWD M Dsn1Δ257 = Dsn1 residues 1–257 are deleted (Dsn1 Δ1-257 ). K HB-RWD M Dsn1Δ226 = Dsn1 residues 1–226 are deleted (Dsn1 Δ1-226 ). K HB-RWD M Dsn1Δ226-2E = Dsn1 residues 1–226 are deleted and Dsn1 S240E and Dsn1 S250E phosphomimetic mutations (Dsn1 Δ1-226,S240E,S250E ). CENP-C Mif2_1-63 is indicated within a red box. (D) ITC data for (i) CENP-C Mif2_1-38 interactions with KM, and (ii) CENP-C Mif2_1-38 interactions with KM 2E . K D and n values are an average from three experiments (technical repeats). Source data are available for this figure: .
Article Snippet: CENP-U Ame1_1-33 (MDRDTKLAFRLRGSHSRRTDDIDDDVIVFKTPNW-amide), CENP-U Ame1_1-33-Mut (MDRDTKLAFRLRGSHSRRTDDIDDAAAVAKAPNW-amide), and
Techniques: Inhibition, Binding Assay, Staining, SDS Page
Journal: Advanced Science
Article Title: PLAUR + Neutrophils Drive Anti‐PD‐1 Therapy Resistance in Patients with Hepatocellular Carcinoma by Shaping an Immunosuppressive Microenvironment
doi: 10.1002/advs.202507167
Figure Lengend Snippet: PLAUR inhibitor reverses the immunosuppressive phenotype of neutrophils and attenuates tumor progression. A) Flowchart depicting the screening strategy for small‐molecule compounds targeting PLAUR. B) The affinity of 40 candidate small‐molecule compounds targeting PLAUR detected by SPR analysis. C) Schematic diagram of the predicted docking structure of DAPTA and PLAUR. D) Cell viability of DAPTA detected in human neutrophils. E) Western blot analysis of PLAUR, phosphorylated and non‐phosphorylated NF‐κB expression in human neutrophils treated with DMSO or DAPTA (5 µ m ). F) quantitative PCR analysis of the indicated genes in DMSO and DAPTA treatment groups ( n = 3 per group). G) Flow cytometry analysis of CD206 and CD95 expression in DMSO and DAPTA treatment groups (n = 3 per group). H) Schematic showing the treatment plan and establishment of spontaneous HCC models in mice. I) Representative images of the spontaneous tumors at the study endpoint (5 mice per group). Scale bar: 1 cm. J) The maximum tumor volume of each group at the study endpoint ( n = 5 per group). K) Kaplan‐Meier survival curves for mice ( n = 5 per group). L) Immunofluorescence staining and statistical analysis of PLAUR, F4/80 and CD8 in the indicated groups ( n = 5 per group). Scale bars: 100 µm. M,N) Flow cytometry analysis of Ly6G + CD206 + neutrophils, CD11b + F4/80 + macrophages and CD3 + CD8 + T cells in the indicated groups ( n = 5 per group). The data are presented as the means ± SDs. * P < 0.05, ** P < 0.01, and *** P < 0.001, Student's t test.
Article Snippet: For PLAUR inhibitor treatment, mice were treated intraperitoneally with
Techniques: Western Blot, Expressing, Real-time Polymerase Chain Reaction, Flow Cytometry, Immunofluorescence, Staining